| Antigen: | Trefoil factor 1 (TFF1) also known as pS2 / pNR-2 Estrogen-regulated protein Ab-2 |
| Clone: | GE1 |
| Subclass | IgG1 |
| Species Raised In: | Mouse |
| Immunogen: | A synthetic 31-mer peptide from the C-terminus of human pS2 protein |
| Epitope: | Residues 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) |
| Positive Control: | Normal stomach or breast carcinoma |
| Cross Reactivity: | Human |
| Applications: | Immunoprecipitation |
| Relevance: | pS2 is a cysteine-rich, 6.5kDa protein found in both oestrogen-dependent (breast tumours) and oestrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Staining is cytoplasmic, often with localisation to the Golgi apparatus. pS2 is primarily expressed in oestrogen receptor-positive breast tumours. |
| References: | Williams R et al., 1996 Hum Pathol. 27:1259-66 PMID: 8958295Read more |
© Cancer Research Technology 2012